Advanced PC Tweaker (tweak Windows PC) free download Advanced PC Tweaker is a solution for Windows users who wish to tweak PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean drive space, manage backup, optimize system, do multiple Windows tweaks Advanced PC Tweaker is a results-oriented solution for Windows users who wish to tweak the PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean up drive space, manage backups, optimize system, apply Windows tweaks and other advanced toolkits like eliminating privacy tracks, administering startup applications, uninstalling unwanted applications and permanently erasing files. Features: -Fix PC Problems with Registry Cleaner, Errors Utility, IE Repair, Block ActiveX, Register ActiveX. -Free up Disk Space with Junk File Cleaner and Duplicate Cleaner. -Completely manage the backup files, including backup for registry files and system download   
 Example: Adobe Photoshop • Top 1000
• Smart reviews
   
Search:   
     

Home > Software > Utilities > System Tools > download now Advanced PC Tweaker (tweak Windows PC)

  Popular:
CryptQuick 1.0
CryptQuick is a file security tool. It can encrypt and…
Checkbook 4.09.08 new!
Checkbook is an electronic checkbook register. You enter…
Servers Alive 6.1.2004
Servers Alive automatically monitors critical server…
DoInventory Plus 5.0.1 new!
DoInventory is your total asset tracking and inventory…
Convert-O-Gadget 1.0.0.7
Make conversions from one unit of measurement to another…
PMX 2.28 Build 20050928
PMX is a simple Project Management application for Mac OS…
PIMOne 2.1
PIMOne is an easy-to-use personal information…
CDBF for Linux 2.99.02
CDBF is a powerful database viewer and editor that lets…
Anti-BO 1.5b
Anti-BO is a listening device which sits in your system…
Aurora 2.1
Aurora lets you use LaTeX to enter mathematics in word…
Best 1000
  TOP-10:
HealthMonitor 2.7.0
HealthMonitor software is a easy-to-use Windows program for…
AgendaMax Plus 4.2.0.17104
Calendar software that tracks your appointments, tasks…
Security Folder 2.0
This application combines the ultimate power of…
JamDTA.net 4.0.7
JamDTA.net is a component for the Dot.Net Framework that…
Advatrack 5.84
Lost stolen computer tracing software
Dewqs' SpamProx 2.9
Spam Proxy : seamless interface between your email client…
TimePunch 1.82.04
TimePunch offers you all the features you expect from a…
DayBook 1.0
Visual, browser-based drag-and-drop time-tracking…
Bar Code 3 of 9 4.2
Print bar code 3/9 from Windows using TrueType or…
Pragmatic Office 7.8
Pragmatic Office allows sales reps to track prospects…
  Sponsored links 
  New:
Joyfax Server 4.651104
JoyFax Server software that allows you to send and receive…
VisiFly 2.3.4
VisiFly is an easy-to-use program to convert your video…
FlashDetective 2.9
Need a sure solution for recovering lost, corrupted or…
eMailTrackerPro 9.0e
eMailTrackerPro helps identify the true source of emails to…
Seo Blog Submitter 1.2.5
Search dofollow blogs powered by popular blog platforms…
TimeGuard Pro 3.0
TimeGuard is smart and active time tracking software, that…
FindGraph 2.12
FindGraph is a graphing, curve-fitting, and digitizing tool…
BackUpTime 1.6.3655
We have created BackUpTime just for that reason to provide…
Dydelf 1.03
Simple tool for spicing up ordinary images, digital photos…
     
Home
News
Software
Books
Smart reviews
New soft
TOP-10
Best 1000
All Soft
Audio & Video
Business
Development Tools
Education
Games
Graphics
Home/Hobby
Internet
Desktop
Utilities
Security
Backup & Restore
File & Disk Management
Password Recovery & Management
File Compression
Encryption
Automation Tools
Registry Tools
Search Tools
Antiviruses
Network Utility
Internet Tools
System Tools
Clipboard Tools
Data Recovery
Shell Enhancements
Print Tools
Editors
Optimisers & Diagnostics

Advanced PC Tweaker (tweak Windows PC) 4.2.9  del.icio.us Fark digg Reddit MyWeb BlogMarks Furl Jots   ( View screenshot )


URL:
HTML:
Advanced PC Tweaker is a solution for Windows users who wish to tweak PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean drive space, manage backup, optimize system, do multiple Windows tweaks

Updated Nov 6, 2009 10:18:21
Size3076 kb
LicenceShareware
StatusMajor Update
LanguagesEnglish
Tagstweak pc, pc tweaker, tweak xp, tweak vista, xp tweaks, tweak windows, tweaks windows xp, tweaks windows vista
OSWindows 95, Windows 98, Windows ME, Windows 2000, Windows XP, Windows 2003, Windows Vista
Homepageadvancedpctweaker.repairandsecure.com
Emailcontact@repairandsecure.com
AuthorMike Hiller
Advanced PC Tweaker (tweak Windows PC) free download Advanced PC Tweaker is a solution for Windows users who wish to tweak PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean drive space, manage backup, optimize system, do multiple Windows tweaks Advanced PC Tweaker is a results-oriented solution for Windows users who wish to tweak the PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean up drive space, manage backups, optimize system, apply Windows tweaks and other advanced toolkits like eliminating privacy tracks, administering startup applications, uninstalling unwanted applications and permanently erasing files.

Features:
-Fix PC Problems with Registry Cleaner, Errors Utility, IE Repair, Block ActiveX, Register ActiveX.
-Free up Disk Space with Junk File Cleaner and Duplicate Cleaner.
-Completely manage the backup files, including backup for registry files and system download

 Zoom click for full size
Other author's software:
  • RegistryEasy 2009.101 — RegistryEasy is award-winning Windows Registry Cleaner that scans your PC and safely cleans errors and invalid entries that cause system slowdowns,freezing and crashing. RegistryEasy repairs registry problems to make your PC run like new again!
  • XoftSpy-SE (spyware remover) 2009.101 — XoftSpySE detects and perfectly removes more then 300,000 harmful, dangerous and likely unwanted applications. Remove Spyware, Adware. Stop Pop-ups. Kill Trojans, Worms, Viruses. Clean Registry & Program Errors. One solution of many problems.
Show all author's software

Description:
   Advanced PC Tweaker is a results-oriented solution for Windows users who wish to tweak the PC system to the best performance; with the built-in powerful components, allowing you repair errors, clean up drive space, manage backups, optimize system, apply Windows tweaks and other advanced toolkits like eliminating privacy tracks, administering startup applications, uninstalling unwanted applications and permanently erasing files.

   Features:

   -Fix PC Problems with Registry Cleaner, Errors Utility, IE Repair, Block ActiveX, Register ActiveX.

   -Free up Disk Space with Junk File Cleaner and Duplicate Cleaner.

   -Completely manage the backup files, including backup for registry files and system backup.

   -Optimize PC Performance with System Optimizer and Memory Tweaker, Advanced Windows Tweaks.

   -Maximize PC productivity and offer you more joyful moments with Privacy Cleaner, Startup Manager, Uninstall Manager, File Shredder.

   -Submit the problems that can't be solved or the unwanted applications can be uninstalled.

   Download Advanced PC Tweaker now and get multifunctional, all-in-one tool to tweak PC for best speed and stability.
Short tags:
tweak pc, pc tweaker, tweak xp, tweak vista, xp tweaks, tweak windows, tweaks windows xp, tweaks windows vista
System Requirements:
Pentium 400 MHz, ~20 MB drive space, 64 MB RAM
Change Info:
Minor bug fixes and stability improvements
find all version  Find last version of Advanced PC Tweaker (tweak Windows PC)
      Freeware alternatives Advanced PC Tweaker (tweak Windows PC) 4.2.9
Free Download now  Free Download Advanced PC Tweaker (tweak Windows PC) 4.2.9 from advancedpctweaker.repairandsecure.com

Similar software shotlights:
  • Advanced XP Tweak 2.52 — Advanced XP Tweak allows you to fine-tune your Windows XP and Internet Explorer easily and safely. It is the best way to tweak and optimize your Windows XP system. Advanced XP Tweak gives your system…
  • Easy Tweak 1.7.3 — Get access to hidden options of Windows to tweak and tune up your system. With Easy Tweak you can take control of your Windows system with access to powerful tweaks and hidden Registry settings. The…
Find all software similar on Advanced PC Tweaker (tweak Windows PC) 4.2.9

Similar news:
Find all news similar on Advanced PC Tweaker (tweak Windows PC) 4.2.9

Similar smart reviews:
  • Vista Style Elements Icon Set, Do You Have a Dream? — As a developer, don’t you have a dream that the day will come when users will be able to comprehend the logics of your programs without your assistance, and your technical support service will finally take a break from those round-the-day silly questions like «How do I go around this menu?» or «What is that button for?» or «What…
  • Mines XP — There are games that were once created to stay for long. They do not demonstrate mind-numbing graphics, feature amazing soundtracks and cutting-edge in-game technologies that modern entertainment titles have to offer. On the contrary, they are simple, compact, have a rather straightforward «storyline» and are primarily intended for testing your skills and entertaining you during short breaks in your…
  • XP Tools 7.76, Rule Over Your Windows! — When you’re trying to enchance and control your Windows, you have many options and utilities. The two most common extremes are «one utility for each single function» and «a suite for all service tasks». XP Tools software follows the second approach, and I should say it does the best in the logical organization and effective control. Let’s take a short guide through…
  • AlphaXP - all you need to have full control over transparency in Windows XP — Transparency is one of the coolest features that Windows Vista can boast. It creates the eye-candy effect that so many users expect to see in a next-gen OS, but, unfortunately, does not have much practical value. Although you can see through window elements, the underlying objects are blurred and the content of the window is not transparent at all — so, for instance, you…
  • Local Account Manager - comprehensive access rights management in Windows XP Home — Windows XP Home is a great operating system that offers everything necessary for a typical home computer for a price any household can afford. However, it lacks some of the more advanced features found in the Professional edition — and the ability to manage users’ access rights and permissions tops this «wanted» list. If you would like to stay with the Home edition…
  • Registry Booster, Speed Up PC the Right Way — Your computer’s gotten too slow? — Maybe it’s just thinking about something. Why not? It has been working for you so hard; can’t it take a rest for a few moments? You thought that was a joke? Well, no, it’s not! The thing is a computer can actually get overloaded with «thoughts». But they ought to be business-related not…
  • Oxy Cube, When a Mobile Meets a PC — By itself, a cell phone is just a device for, basically, making calls. A computer also has nothing special in it when it’s by itself. But what happens when you put these two together? Briefly, they make a feature-packed mobile digital assistant, with no need to buy an expensive PDA or anything else tricky and expensive — just grab a copy of the Oxy Cube…
  • DriveSentry - an impenetrable anti-virus armor for your PC — These days, viruses don’t surprise anyone — they are out there and are not going away any time soon. Therefore, if you can’t fully exclude the possibility of a virus attack, make sure you are well prepared and ready when one happens. If your efforts to find a reliable security solution that fully meets your requirements have been quite unsuccessful and you still haven’t chosen…
  • SpeedUpMyPC 2009 - get an immediate performance boost without upgrading your PC! — It is not at all uncommon that your PC gets significantly slower after several months of operation. New applications and installed and removed, files are written and deleted, settings modified — and all this leads to performance drops over the course of time. Apparently, if you can proudly call yourself a computer whiz, you can handle these problems on your own, but if you are more…
Find all smart reviews similar on Advanced PC Tweaker (tweak Windows PC) 4.2.9


Home > Software > Utilities > System Tools > download now Advanced PC Tweaker (tweak Windows PC)

See software by tags:
Software track multiple projects
Audio decoder mp3
Golf tournament scoring leaderboard
see also:
LingvoSoft Talking Picture Dictionary…
LingvoSoft FlashCards 2008 Spanish…
LingvoSoft FlashCards 2008 Spanish…
See software by tags:
Mp4 joiner download
Block specific pop domain
Batch tools file download tools

Copyright © 2001—2009 3d2f
Concept:
Advertisement.