First Thanksgiving free download Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio = a built-in search engine Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio with a built-in search engine that allows you to search for and add stations   
 Example: WinDVD • Top 1000
• Smart reviews
   
Search:   
     

Home > Software > Internet > Browsers > download now First Thanksgiving

  Popular:
FolderSafe 2.1
FolderSafe is a software tool that lets you hide or…
iSpy Killer 2.1
iSpy Killer is an efficient and smart Spyware, Keylogger…
ActiveDiary 3.5
ActiveDiary is a password-protected diary application. The…
Wine Organizer 3.6
Wine Organizer Deluxe is a complete program that allows…
ITIC SpamFilter 2.3
ITIC SpamFilter is the antispam program. It kills all spam…
ramsetcube R10
Using RAMSETCUBE you could manage the metadata of a Data…
PocketChange 1
Currency conversion between 260+ countries, EURO and track…
iReferent Light 3.02
Easy-to-use Contact Manager for small business and home…
Idea Magic 5.3.2
Idea Magic is based on Roget's 1911 Public Domain…
Ease MP3 Recorder 1.50
Ease Mp3 Recorder makes a complete recording studio of your…
Best 1000
  TOP-10:
Spell Magic 5.3.2
Spell check text, paragraph or document from any…
Invisible Browsing 7.4
Invisible Browsing it’s a software to hide IP address…
CleanMOCache 1.10
CleanMOCache 1.0 is a free (for 1 - 2 systems), very…
Repellent 2.3.04
Repellent protects you from all scrip viruses and email…
Beckham RM to DVD 1.0.78
Beckham RM to DVD is the best RealMedia converter software…
DataPouch 1.0.330
DataPouch is an Organizational Tool for storing bits of…
EazyEFT 1.36
EazyEFT is an easy to use utility for the management…
Easy Projects .NET 6.0.2
Easy Projects .NET is the easiest all-in-one web based…
ActiveTreeNotes 1.0
ActiveTreeNotes is a blazingly fast, very simple to use…
Autoshare 3.32
AutoShare is the easiest-to-use share investment software…
  Sponsored links 
  New:
Axence nVision 4.1
Comprehensive network management: proactive network…
z/Scope TN3270 6.2.0.83
z/Scope Express is a SSL-enabled multi-session terminal…
PDF-Analyzer 4.0
The PDF-Analyzer is a tool extracting all attributes from…
SmartAssistant 2.3.24
SmartAssistant is an easy-to-use PIM software enables you…
Personal Finances 3.8
Personal Finances is a freeware personal finance…
MaterialNet 3.38
MaterialNet is designed for manufacturer, factory…
DBF Doctor 2.2.396
Lost important data in a corrupt dbf-file? You are in for…
EfficientPIM 2.79
EfficientPIM is a full-featured personal information…
SQL Pretty Printer 3.0.5
SQL Pretty printer is a tool to beautify sql code in any…
     
Home
News
Software
Books
Smart reviews
New soft
TOP-10
Best 1000
All Soft
Audio & Video
Business
Development Tools
Education
Games
Graphics
Home/Hobby
Internet
Desktop
Utilities
E-mail
Privacy & Security
Ftp
Chat
Browsers
Download Managers
Anti-SPAM
Search Tools
Offline Browsers
Promotion
Ad Killers
Firewalls

First Thanksgiving 1.0  del.icio.us Fark digg Reddit MyWeb BlogMarks Furl Jots   ( View screenshot )


URL:
HTML:
Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio = a built-in search engine

Updated Nov 8, 2008 15:51:42
Size1278 kb
LicenceFreeware
StatusMinor Update
LanguagesEnglish
TagsFirst Thanksgiving, Squanto, Squantos Secret Garden, Protogrow, toolbar, add ons, ie toolbar, mozilla toolbar
OSWindows 98, Windows ME, Windows NT, Windows 2000, Windows XP, Windows 2003, Windows Vista
Homepagefirstthanksgivinggarden.com
Emailrikaridge@gmail.com
AuthorRika Ridge
First Thanksgiving free download Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio = a built-in search engine Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio with a built-in search engine that allows you to search for and add stations

 Zoom click for full size
Description:
   Official First Thanksgiving toolbar. Support our site by installing the new, completely customizable toolbar. Features include: Google-powered search window; a weather link, critical for gardeners; an imbedded radio with a built-in search engine that allows you to search for and add stations
Short tags:
First Thanksgiving, Squanto, Squantos Secret Garden, Protogrow, toolbar, add ons, ie toolbar, mozilla toolbar
Free Download now  Free Download First Thanksgiving 1.0 from firstthanksgivinggarden.com

Similar software shotlights:
  • gardening seeds 1.0 — gardening seeds toolbar for Mozilla Firefox. Find news articles and information about gardening seeds, garden supplies, and gardening hints and tips. gardening seeds toolbar for Mozilla Firefox. Find…
  • webkinz secret codes 1.0 — webkinz secret codes toolbar for Mozilla Firefox. Find webkinz secret codes and recipes. Learn about webkinz secret codes and webkinz adoptable pets. webkinz secret codes toolbar for Mozilla Firefox…
Find all software similar on First Thanksgiving 1.0

Similar news:
Find all news similar on First Thanksgiving 1.0

Similar smart reviews:
  • Liveye BladeBox eXtreme 4.0.1. Secrets behind Your Fingertips — Let’s talk about secure storages. A secure storage, for a «mere mortal», definitely should have some obvious properties. The number of those properties is small, but all of them should exist, and all of them should be at an ultimate level. In a few words, there should be the ultimate reliability of the protection and the ultimate ease of use. The first one…
  • Trust Toolbar — Trust and reliability is something we strive to find in both real and virtual worlds. This is by far one of the greatest problems in our lives, but it truly becomes a challenge of ultimate complexity in the exponentially growing online space. Hundreds of millions of websites, hordes of hackers, credit card fraud, meticulously crafted website clones used…
  • Gadgetbar Toolbar, Preserve Security, Boost Productivity, Improve Communication — What, in your opinion, would be necessary to maintain one’s computer in the proper, working condition? Are you thinking of a long list of expensive utilities? Or, maybe, guessing about a special university degree? — Believe it or not, all you’d need to have in order to get the job done is a bit of faith and a one-Meg setup file…
  • Easy Adder 1.7.3, It's All About Communication — The new age of Web, with its social services, had extended ways of communication far beyond usual e-mail/IM measures. Social services like MySpace have introduced a very important concept of a «friend», which, despite its name, means a completely new thing in the world. This concept with related actions (like «Add as a friend») alongside is a completely new method…
  • AdSense Toolbar - keeping your finger on the pulse of your AdSense campaigns — Google AdSense is the most popular and probably the easiest way for an owner of a site with high-quality specialized content to generate extra revenue. If you have just launched your website and would like to be always updated about the performance of your AdSense ads or have had a site for a while and are now adjusting content to generate more clicks, try AdSense…
  • Perspector Professional Edition – add a new exciting dimension to your presentations! — PowerPoint presentations containing text and graphics are the most popular method of delivering complex business and scientific messages to audiences. However, excessive use of bulleted lists and plain charts may diminish the effect you intend to produce with your presentation. In hectic business environments, people want to grasp the essence of your message as soon as possible and not waste time…
  • AlphaControls - adding fashion to your applications has never been easier — As a developer, you should be primarily concerned with the functionality of your application and its stability in different conditions. As a smart developer, you should also be concerned with the appearance of your products. This important factor often becomes the final incentive that makes people choose a specific product among dozens of identical ones. Therefore, creating applications with…
  • AutoDirector - an easy way to add a car showroom to your website — A good online car catalog should possess several important characteristics — intuitive navigation, short loading times, ease of support and maintenance and completeness of product information. If you are building a car rental or sales website for your own company or your client, you can choose to build this module on your own or opt for an available third-party application…
Find all smart reviews similar on First Thanksgiving 1.0


Home > Software > Internet > Browsers > download now First Thanksgiving

See software by tags:
Record stream
Surf offline download
Remove simlock samsung
see also:
ImageFans
CF Screensaver Editor
Jezzballix
See software by tags:
Download limiter
Google earth google earth map
Ebay automatic bidding

Copyright © 2001—2009 3d2f
Concept:
Advertisement.